DPCstruct | MC24968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 146 ± 25 aa |
| Standard deviation of domain lengths | 25.43 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 39.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12638 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0QSR2 | 14-149 | REGVTKREPIMPRRYTLTHSDITAELFLTIGSTYAFDQINPMRDEVLGEWILNGENYIYMAYVYVDGGGPYNPATATIRNQVFRREL… |
| K0AYV0 | 3-126 | RYYTLTHSDITGELFLTIDYYYAYDKITSMRDEVFGQWTKVNDRYFLNIYLCIDGEGNIETIPIRDMIFRRELPLALEAIRYGDKEF… |
| A0A7J0FR96 | 1-110 | None |
| A0A5N6NZB2 | 31-126 | None |
| A0A2H5NTA8 | 11-174 | None |
| A0A822XSP5 | 55-190 | None |
| A0A4S4EVU5 | 214-338 | None |
| A0A6S7NS82 | 1-102 | None |
| T1LCZ8 | 568-729 | None |
| T0CW04 | 7-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.