DPCstruct | MC24964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 205 ± 25 aa |
| Standard deviation of domain lengths | 24.75 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A357CZL3 | 2-171 | TAILNAILAEVTTVEYTPCTITGIGDPSLQAGDFINIALNGSIVTSYLTHSTWKFRGSHTLKSVGQSAVLKSKYSQSEKSTNAIKKT… |
| A0A6L4LFQ2 | 27-221 | KDVNSLNKIAKNYFKTINPGCDKPKISITVEFDKLTDTEEGKEFAKIRNYGLFDTFKIYHRKYKLYFESKVSGVQYDSLSEKVLKLE… |
| V9G627 | 134-351 | None |
| W7Y9C6 | 61-258 | None |
| A0A1V5KSU5 | 110-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.