DPCstruct | MC24960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 109 ± 8 aa |
| Standard deviation of domain lengths | 8.07 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2TJG6 | 76-184 | LASNDVFVISNSSAAKAGITSNSDTTHTMTFYNGDDAVILINKATGDTLDIIGVIGVDPGSGWTVGSGATNNFTLVRNYNVKNGTKD… |
| A0A3C1C1D0 | 127-229 | LANSSASAAILNVADMTSGSLTFNGDDAVVLRSGGTNGPVVDSIGVVGTDPGTEWGTGLTSTADNTLRRKATVKQGDTNTVDAFAPA… |
| A0A1V6F8T1 | 413-522 | None |
| A0A7V1BWW5 | 44-135 | None |
| A0A7L6N7S9 | 203-299 | None |
| A0A2E6VTR9 | 257-362 | None |
| A0A2E8XX39 | 1-113 | None |
| A3TTF6 | 221-326 | None |
| A0A2N1QJ75 | 510-612 | None |
| A0A2N1QHU9 | 413-523 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.