DPCstruct | MC2496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 138 ± 19 aa |
| Standard deviation of domain lengths | 18.73 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7I4K0 | 4-115 | FSSSSSPSSDLPLKPIPGDYGLPFFGAFKDRLDYFYNQGEDEFFHSRIAKHSSTVFKTNMPPGPFIASNPRVIAVLDAVSFPVLFDT… |
| A0A6A3C1X3 | 1-150 | MAAMMCMPPPSFSSPLASQSLSAPSRQASNLPLRTIPGSYGWPLVGPISDRLDYFWFQGPDTFFRSRMEKHKSTVFRTNVPPSFPFF… |
| A0A0R0ID53 | 22-123 | None |
| A0A7J0FB19 | 1-157 | None |
| A0A834ZN78 | 29-170 | None |
| A0A540M789 | 28-200 | None |
| A0A6J1C2S5 | 1-155 | None |
| A0A6V7NVT4 | 252-384 | None |
| A0A5A7TDQ8 | 5-143 | None |
| A0A6A1V3C1 | 1-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.