DPCstruct | MC24954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 81 ± 12 aa |
| Standard deviation of domain lengths | 12.21 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R4LKF7 | 187-268 | IPHFSEVTPRKLGQIERAEAALRGLGFHDLRVRHHDEVARLELTPADMVRAVTDPVRREVHAAITAAGFRFVALDLAGVQSG |
| A0A174BAD8 | 10-90 | YGSVITREKLKKIEIAEEFLLSNNFKQFRVRYYDDLAKIEVLKEDIPKVLQLSEVIIAKFKEIGFNYITLDLEGYRTGSMN |
| A0A7J2S7B4 | 251-333 | None |
| A0A1C5N2M2 | 646-727 | None |
| A0A7C2WLE9 | 335-415 | None |
| A0A239QSA7 | 539-615 | None |
| A0A7X9PYX3 | 177-259 | None |
| A0A843DN51 | 48-146 | None |
| A0A1M6M1R0 | 321-408 | None |
| A0A382X503 | 6-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.