DPCstruct | MC24951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 206 ± 18 aa |
| Standard deviation of domain lengths | 17.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 43.36 |
| Pfam Score | 69.05 |
| Assigned Pfam label(s) | PF00566- PF12473 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q1AUX1 | 1-214 | MGKSSDGKAYIITGTWNPNMAAFQPLNEDTPKDKQVYMTVAVDLVVTEVVEPVRFLLETLVRVYPSNERFWYFSRKTFSEMFYLKLR… |
| A0A7J7SSW3 | 22-238 | MGKSYDGRAYVITGMWNPNAPIFLALNEETPKDKRVYMTVAVDMVVTEVVEPVRFLLETVVRVYPANERFWYFSRKTFTETFFMRLK… |
| A0A816HHL0 | 1-189 | None |
| A0A3P7HJC5 | 88-259 | None |
| A0A402EIY6 | 538-768 | None |
| L5KXY0 | 128-331 | None |
| A0A3M7REH7 | 334-535 | None |
| A0A819Q3I9 | 1-198 | None |
| A0A814QU55 | 343-570 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.