DPCstruct | MC24950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 566 |
|---|---|
| Mean domain length (aa) | 223 ± 45 aa |
| Standard deviation of domain lengths | 44.59 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.76 |
| Pfam Score | 70.27 |
| Assigned Pfam label(s) | CL0137- PF20481- CL0704- PF00689- PF00122 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8GZB9 | 2-119 | VPHYAVCIRDGEKMNLKVEELTLGDLIDVKLGDRLPADIRIIDSKNFKVDNSSLTGESEPQSRSREFTHENPLETKNIAFFSTHAVE… |
| A0A3Q1AN93 | 42-291 | KRRTVFLLKLYKGNKIRTTKYSLLSFLPKNLFEQLHRFANVYFIFLAALNFVPVVEAFQPEISVIPIILVLSVTAVKDIWEDYCRFK… |
| A0A444X418 | 61-235 | None |
| A0A819MST1 | 348-580 | None |
| A0A2D6QTI5 | 173-423 | None |
| A0A534WFU0 | 555-757 | None |
| K8EKJ0 | 439-686 | None |
| A0A0C2IX18 | 213-482 | None |
| A0A1A7XFN7 | 2-212 | None |
| A0A2D0Q571 | 3-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.