DPCstruct | MC2495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 84 ± 9 aa |
| Standard deviation of domain lengths | 9.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 54.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3BVU1 | 17-92 | GKLELELIYKVQMQCYEDAKLMKLFPEIVRSLYDQDVLAEDTILHWFRKGTNPKGRQTLVKSLEPFIKWLEEAEEE |
| A0A803T4X6 | 253-341 | LKQYAPLLAVFSTQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHLAKGKSVFLDQMKKFVEWLQNA… |
| A0A1J1IHR8 | 548-636 | None |
| A0A6J2U1Z4 | 323-412 | None |
| A0A498MLJ2 | 313-402 | None |
| A0A4Y2CDB7 | 457-543 | None |
| A0A7J9DVC4 | 1-70 | None |
| A0A816KEH4 | 392-467 | None |
| A0A5A9P926 | 26-101 | None |
| A0A371F1H8 | 351-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.