DPCstruct | MC24949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 146 ± 18 aa |
| Standard deviation of domain lengths | 18.44 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R8P7K3 | 359-499 | LFQRLYAEHGYHDFAVGFMAAGPNAFVQCESVLPYSFSGAIDSWASGVLFDIVNVDGQKLSFANRGQDGQGAGWTAANSVFWQSTAG… |
| A0A4R2WD10 | 24-158 | GPVVLLNCIFKGNGWIQPHQRWATGLLIDNCQVPNGGIDFMNRGSMGSGHGWSIGWAVAWNCTARSYLNQLPPGSVNWVIGCKGDPQ… |
| A0A353RN55 | 357-503 | None |
| A0A387HSK3 | 2-107 | None |
| A0A3R7YYQ7 | 812-963 | None |
| A0A7K1M2N3 | 357-489 | None |
| A0A2P6NE71 | 1103-1257 | None |
| A0A2P6NET4 | 73-227 | None |
| A0A2E7ZTX2 | 694-845 | None |
| A0A2T4XBR9 | 23-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.