DPCstruct | MC24948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 5.78 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0ZL55 | 39-114 | MPTNPELLGFGSEWYKEAFEAATLQSLPSGKRIYMITAPYFLACKLAAFRNRGEGDYLMSHDMEDIVTVLDGRPEV |
| A0A2N6C2Z2 | 20-95 | MPTHQQIFGFGSPWYEEAMRHSISQELPSGKLIRMITAPYFLACKFAAFDNRGNNDFMMSHDMEDIVAVVDGRPGL |
| A0A7Y0FDB4 | 1-76 | None |
| A0A1Q5PDE4 | 53-129 | None |
| A0A1F4P7L9 | 6-81 | None |
| A0A0D9SHN2 | 304-395 | None |
| A0A5C2F118 | 2-80 | None |
| A0A1Y0I808 | 69-147 | None |
| A0A6N1XFN1 | 98-173 | None |
| A0A6G7C3V7 | 45-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.