DPCstruct | MC24945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 109 ± 3 aa |
| Standard deviation of domain lengths | 3.40 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 83.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E2NE12 | 5-112 | NPETYLQKALKNQGLEDTPARMKENWIDGDYKYTVRVHEGNSTYTDADSIYRVSRKSTVVDEFGQGRGLEYLGTDGNWYQESVLKEF… |
| A0A4R2VSS7 | 1-106 | MEGFESGEVIPRGYKKEWIAGGYKYEVRVHPSNKKYAESKDILRVGRKQVDADGKGIGKGMEYLDIHGEWHPEKVLKPKSKNGIPNP… |
| H1GFL1 | 28-138 | None |
| D1YPJ3 | 29-142 | None |
| A0A2T7BMS2 | 584-687 | None |
| A0A4U2Z0Y3 | 248-353 | None |
| A0A1H9PX83 | 130-240 | None |
| A0A7X5CUN8 | 477-590 | None |
| A0A1I1RYC6 | 79-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.