DPCstruct | MC2494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 7.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 69.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3BTW7 | 1-91 | MSPSLAYANTLFFRSAYNVQVIMDDNEPEERLLNRFRRDVMRAGVIQVCKRRKFFENKQDDKKRKSREAAKRNRRRHDNIIVSENPL… |
| A0A830BD50 | 96-161 | FNSAYNIQVVVGEHEPEENLINRFRRDVLRAGVLQECKRRRFFECSQEKRKRKTREAAKRNRKRFV |
| A0A200QI12 | 1-67 | None |
| A0A835RPJ5 | 81-151 | None |
| U5D1T5 | 1-73 | None |
| I3RZW2 | 71-152 | None |
| A0A7J7I3D1 | 129-208 | None |
| Q6YUV4 | 44-122 | None |
| A0A5D2JDF7 | 79-145 | None |
| A0A6A4R1N3 | 54-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.