DPCstruct | MC24934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 182 ± 20 aa |
| Standard deviation of domain lengths | 19.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A229G7M7 | 1-218 | MNSHLNIFKTYTATDREHQLENDLTRALAICFQEDPLFFHKVLEDMFSSTLYYEKLFGSINADTSITIDIQRQADQINGYEHIFAVS… |
| A0A150MXI0 | 3-188 | HLNYFFPYERKDAHHEDQLTRALLVTLKMVPFIQHMFIEMIREKMFDKNVNTVNIAPSLVNTEHRIERIETQVKKISQDSGKLISIL… |
| A0A6G2CIU7 | 1-193 | None |
| A0A1C4ARR0 | 13-218 | None |
| A0A7D4YAR0 | 9-205 | None |
| A0A7C1SKT3 | 1-149 | None |
| A0A830FC69 | 3-186 | None |
| A0A660LCU0 | 2-162 | None |
| A0A7C4YCC3 | 1-167 | None |
| A0A2H9L9R9 | 16-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.