DPCstruct | MC24933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 170 ± 39 aa |
| Standard deviation of domain lengths | 38.54 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0291 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7P4Z9 | 3-112 | TTSNFTFLESEFPILYNIGISAEYNLHQDPATCLWKIRGFGERVTEILFKEHALKFPTENNFANRLRLLGFEGVLPQAVKDLFYHIR… |
| A0A150MJK7 | 11-181 | FRFLEEKWEVLARVGETVERNVYQNPNVAMSELRKFAETITKYILALEEIREERGTDQQERLRVLFYEQIIPKEIYDLLTVIRLKGN… |
| A0A3B0CJH3 | 1-131 | None |
| A0A2I8AHA1 | 1-212 | None |
| A0A2N6RCY7 | 5-184 | None |
| A0A1Y4H4H4 | 7-149 | None |
| A0A357T2P0 | 6-127 | None |
| A0A1V1VD48 | 3-222 | None |
| A0A4R2XHZ8 | 6-166 | None |
| A0A3R6V338 | 1-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.