DPCstruct | MC24932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 56 ± 4 aa |
| Standard deviation of domain lengths | 3.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20095 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4YQZ6 | 34-89 | LASCNCSYEPCARKGICCDCISYHIKSRQLPGCCFPADAEKTWDRSFEHFARLVGE |
| A0A0S8KS06 | 9-63 | LEDCGCTYPGCERKGTCCECLSYHLSSKQLPGCCFPPEVEKTYDRSFKGFAKAWG |
| A0A496UIP1 | 4-58 | None |
| A0A847YSP8 | 2-53 | None |
| D2C615 | 214-266 | None |
| U4R4R3 | 8-64 | None |
| A0A0B5FTK5 | 8-63 | None |
| A0A1V5KLE7 | 2-55 | None |
| A0A0F0CNX9 | 52-115 | None |
| E3GDX4 | 16-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.