DPCstruct | MC2493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 79 ± 11 aa |
| Standard deviation of domain lengths | 10.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 54.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12174 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2LM72 | 34-93 | MPFPMLFAAISNKVPRKDMALVTYHYGLFRAKKISRENFVKRLRLIVGDSLLRSTIMKLQ |
| A0A6A3BPV5 | 1-82 | MSFPMLFAAISNKIHRTDMKQVSNHYESFSVKKITHDDFVKKLRLVVRDYLLRSTITSLQRKIPSRHELEVAIQNMKDPKSL |
| A0A446JWS0 | 280-344 | None |
| A0A453ML13 | 33-112 | None |
| A0A0L9VTK5 | 280-376 | None |
| A0A178WHJ2 | 1-82 | None |
| A0A7N2N7E9 | 1-82 | None |
| A0A835KDF6 | 544-623 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.