DPCstruct | MC24928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 88 ± 16 aa |
| Standard deviation of domain lengths | 15.53 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 21.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7VDB2 | 1-64 | MKASVKEIQDSGKVIVLDDGSTWSVSSFDAFNTRMWMRFDSIEINFNKLTNLSRGNQTVDARRV |
| A0A2H0VQ19 | 73-151 | LSRGYQQLPTIAEVTFSGQFIRLDDDTIWQIDPKDTAVTQGWLTPVPIKVEYTAVGAYPYTLTNTVTSSKVHARKVSHI |
| E1QJ99 | 19-96 | None |
| A0A7W0FWD8 | 121-221 | None |
| A0A7W1CG43 | 248-350 | None |
| A0A517LZQ5 | 107-176 | None |
| A0A6M1Z2Q1 | 191-287 | None |
| A0A7W1KJQ2 | 16-113 | None |
| A0A6M1ZB74 | 75-178 | None |
| A0A069RHX0 | 264-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.