DPCstruct | MC24926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 165 |
|---|---|
| Mean domain length (aa) | 140 ± 32 aa |
| Standard deviation of domain lengths | 31.54 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.56 |
| Pfam Score | 98.81 |
| Assigned Pfam label(s) | CL0123- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A235BXH2 | 16-163 | VYEKSLSSIIKKVEESKHKAITTVNKLLIELYWYIGKTITELQERSKWGDGVVERLSQDLRMKYPNQSGFSSRNLWDCKRFYLAYRN… |
| A0A3D9AL98 | 6-144 | DSLFQSIKEIINQSREKVFRIANSTLLLTYWQIGQLIVEDEQKGKERAEYGKYTLKKLSKKLTLEFGKGFDESNLRNMRSFYNIFPI… |
| A0A4S4G3Q4 | 40-192 | None |
| R7KMS4 | 24-132 | None |
| A0A7V8BMJ3 | 6-180 | None |
| A0A1S1Y7N3 | 3-91 | None |
| A0A5C7Q737 | 34-198 | None |
| A0A0F9C438 | 68-246 | None |
| A0A7W0ENW2 | 14-126 | None |
| A0A6C1C9A2 | 1-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.