DPCstruct | MC24920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 142 ± 19 aa |
| Standard deviation of domain lengths | 18.91 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.52 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | CL0062- PF21673- PF09762 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0DG46 | 3-110 | DDEEHKNLMNCLDLLIAAGYFRARIKGLAPFDKIVGGMVWCLSHCNRTIDADLLFSENLDIGQKIALTEKIVHVLGALECPHSIEPH… |
| A0A2G9TJE7 | 8-139 | DTNSDDEDNRYLMDCLDLLVAAGYFRARIKGLATFDKIVGGMVWCLSHCNQKIDTFLVFIEDLDIGHKITLTEKVVRVLTDLRCPHP… |
| A0A2N9IUD5 | 1-126 | None |
| A0A7J6VQ77 | 1-144 | None |
| A0A1I7WWA0 | 1-151 | None |
| S9WJL4 | 76-216 | None |
| T1GA42 | 4-133 | None |
| K2HPC9 | 6-143 | None |
| A0A5J4VY99 | 2-155 | None |
| A0A2G5EB05 | 4-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.