DPCstruct | MC2492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 184 ± 33 aa |
| Standard deviation of domain lengths | 33.05 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.35 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | CL0020- CL0316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3BPB2 | 2-202 | ITRRHELGETLKNVGYEKIGIDEAQKTPWESLERDIPPWIQTFKQCANVHLPAERKLVQTIFSGYSSLSDSIIINLARCMFLQFLNF… |
| A0A834D4X2 | 26-166 | IIRQSIVDEGVYHLGVEKLSSSQLNKMDWEVLESKIKNWLDTVKISMRTLFTGEKILCDHVFASSDSIRESCFTEISKQGATILFSF… |
| A0A6S7Q0Z3 | 5-190 | None |
| A0A444YBA6 | 536-704 | None |
| A0A251SKY0 | 2-196 | None |
| A0A453DI11 | 5-157 | None |
| A0A2C9VJN6 | 835-1009 | None |
| A0A396HTJ3 | 27-186 | None |
| A0A6P5MMW1 | 345-591 | None |
| A0A2G5EPY1 | 796-970 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.