DPCstruct | MC24919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 52 ± 4 aa |
| Standard deviation of domain lengths | 3.98 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 54.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287KE31 | 268-322 | LYPTPDMIVLADKSEQKAFKYTGITCFNPGSFANDSTFAAYRPCTKEVELSALES |
| A0A398A5A3 | 154-206 | LYPTPHTIVLGDTSEQKVCKFGGTTCFNPGSFSTDSTFVAYRPSTQEVELSGL |
| A0A287KE28 | 144-198 | None |
| M4BR39 | 214-258 | None |
| A0A7S0XDG2 | 81-135 | None |
| B9G1B8 | 182-236 | None |
| A0A7S3PS82 | 154-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.