DPCstruct | MC24914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 116 ± 16 aa |
| Standard deviation of domain lengths | 15.99 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04669 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M4FS23 | 69-199 | NDPGVEMMWAMKAAQHAEVYFNLISSVDPTFLKLTKVDEEIYTAFRDRFRHLRIDVLEPEELKSEPAKEKWRPFCMQFEGVVEDFNY… |
| A0A2G9T8P5 | 4-110 | LMCCDTRVLRLNKLQDVIHASFRNTFPDLDVHKVTEVELKHGGMKEKWHDFCESFKEVVEDYSLGTLMRIEACKGYSEENTVVVPKI… |
| A0A146I8V9 | 77-191 | None |
| A0A3Q3AR97 | 31-170 | None |
| A0A674GSB7 | 427-554 | None |
| A0A4T0H7Z4 | 270-401 | None |
| A0A5B7EXV7 | 11-101 | None |
| K7FKD4 | 3-125 | None |
| A0A3P6G7R7 | 5-105 | None |
| A0A7J8J987 | 2-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.