DPCstruct | MC24912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 10.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3NZ71 | 47-127 | TGYVFTPTEKEKSDRLLHVRYSATKDQYCRVSNNREVTQSWDQCVWSKESVFRKVENDWQMVYIARTEGSSVGKVSWKFDF |
| A0A2G9T385 | 1-102 | MSGDVEWRAARSELGCSSKQEPSVISLTPEEISNKKFSLEYNCAQDCYTRGTETIKGWSAYANFNGSVQRKQESDWKMAYLCRSENE… |
| A0A7R9CKR1 | 462-565 | None |
| A0A2H2J234 | 1-82 | None |
| A0A816S3W4 | 412-506 | None |
| A0A4W5NPE6 | 40-139 | None |
| A0A6A4X8V4 | 313-386 | None |
| A0A1D1VP15 | 90-187 | None |
| A0A1D1UWV9 | 150-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.