DPCstruct | MC2491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 4.98 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3BNG0 | 1-84 | MFSVFKRINAKEQVVSWYSTGPKLRENDLDIHRLFHNYVPNPVLVIIIVQPKELGIPTKAYYDVEEVKENATQKSQKIFFSCSF |
| A0A0R3R5E8 | 96-177 | EQQYQEVFQDLDYVGWYTIGDTTPTQADWEVHQQFSVMHESPIMVKLDPKAPPGNKLPVAIYESVCTTGLSASSPSSVVWHS |
| A0A2I3LVX3 | 67-141 | None |
| A0A6A4H4V3 | 96-182 | None |
| A0A7R9CZZ0 | 27-105 | None |
| A0A0A9N686 | 158-238 | None |
| A0A7N0THL7 | 64-148 | None |
| A0A816V792 | 1-80 | None |
| A0A1U8IY91 | 2-83 | None |
| A0A6J0L192 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.