DPCstruct | MC24902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 218 ± 48 aa |
| Standard deviation of domain lengths | 48.19 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05987 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7X2Z9 | 4-206 | NLEFRGRWNDIFLNLLLIGILSTITLGLYTPWGYARWKRMIATNTYFDNRPLQFDGSGGQAFVEFLIIGALSLITLGLYTILGFAGV… |
| A0A520Y7L5 | 16-258 | VLYVGLIYLGGFALFRALRYRLSRTWWRGIRGGSEEPGWNYAGEALVYTFLTFITLGLAYPHTQAKLWNSRWNSMSFGSFRFEADLQ… |
| A0A1G3RE47 | 84-297 | None |
| A0A285PD90 | 136-367 | None |
| A0A7V3JSV6 | 2-125 | None |
| A0A7X9HDK4 | 15-247 | None |
| A0A7Z9GVR9 | 2-141 | None |
| A0A2S9YBW6 | 22-290 | None |
| A0A833FWN6 | 109-377 | None |
| A0A355V1Z7 | 2-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.