DPCstruct | MC249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 131 ± 14 aa |
| Standard deviation of domain lengths | 13.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9W095 | 138-282 | KKQVIKTPKLMLALATSALIIGQVGTERWVSKEPKTMGLPMSLNVEPWQVVVRACGNCHSNHTEWPWYSRVPPVSWWIAQHVREGRE… |
| A0A7C5H821 | 6-140 | AIFVLLLILIQLIRPERTNPTTEPKETLHADPDVMKILKRSCYDCHSNETKWPWYSNIAPLSWSIISHVNDGRKALNFSHYVTIDPK… |
| A5L5Q4 | 9-118 | None |
| A0A2H0PA64 | 64-198 | None |
| M6GHQ1 | 10-113 | None |
| A0A3D3GLB9 | 14-137 | None |
| A0A2E6SU04 | 28-169 | None |
| A0A2A5B825 | 6-145 | None |
| A0A3S4WNP9 | 2-145 | None |
| A0A6N7FLT9 | 12-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.