DPCstruct | MC24899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 215 ± 17 aa |
| Standard deviation of domain lengths | 17.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6AXY9 | 1-205 | MNLDKYQQAWKADADQTRVTIDMDLLSQEVQRSQQGFQSSIFWRDVREAGISLILIPIWLVMGYTMSLSWTWYLGIPAFMFVAGFIL… |
| A0A5C5X884 | 1-220 | MNLDEYRQAWKEDEAQMNITFDSDLLSKEVLRSHQSFQSMIYWRDFREVGVSLVMIPLWLLLGSMMSLPWTWYLTIPALIWIAAFIF… |
| A0A142WWM2 | 1-203 | None |
| A0A2H3P1F0 | 2-198 | None |
| A0A5B9MDE9 | 1-200 | None |
| A0A518K356 | 7-247 | None |
| A0A812JPU7 | 161-407 | None |
| M5SDQ4 | 1-207 | None |
| A0A517TQC2 | 15-242 | None |
| A0A2N9NTV8 | 1-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.