DPCstruct | MC24892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 186 |
|---|---|
| Mean domain length (aa) | 104 ± 20 aa |
| Standard deviation of domain lengths | 19.64 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.25 |
| Pfam Score | 98.86 |
| Assigned Pfam label(s) | CL0104- PF01329- CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5ZQG7 | 3-82 | ELISKGWKIEEGKLSKTFEFNNFKEVVMFFNAVAWEAEKMNHHPDTFITYKKCHINLFTHSEGKITNKDVELARKIENIF |
| A0A259DT37 | 13-110 | QPITPNSQRMVIPTVESYLSVLPGWQAGFDYNSIERSIQFKNHYQVMAFLNALAFISHEQDHHPEICYGYNKVTIKLTTHTIKGVSL… |
| A0A2R6CQE2 | 2-97 | None |
| A0A4V5ND60 | 6-111 | None |
| A0A353RWF6 | 183-279 | None |
| A0A834Y1W6 | 350-447 | None |
| A0A438NFM3 | 44-149 | None |
| K2SRT0 | 170-270 | None |
| A0A199VS52 | 1-85 | None |
| A0A2D6E4G3 | 16-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.