DPCstruct | MC24890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Standard deviation of domain lengths | 8.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W8FIZ5 | 31-130 | SDDEQVLFMTTCMETWIACDRGTLRRHYGPNIQESALPPLHDIEQRDRHAIQDALFHATRNCRNPYRKGWNSFEVLGRLDPETLEAH… |
| A0A172U4W4 | 1-107 | MTDDQLHFMVECMENWFFADQESLSKYFGKGFNKNSLTAPVNVERLDKENVYRQLRESTRHLTNKQPYSKGNDSFAILENLDPRKVS… |
| A0A410S4S5 | 2-85 | None |
| A0A150PEN9 | 47-146 | None |
| A0A7C2Y242 | 1-111 | None |
| A0A2N9MQQ4 | 2-92 | None |
| A0A7C8EF64 | 1-94 | None |
| A0A480A089 | 61-174 | None |
| A0A3P1ZYS0 | 117-219 | None |
| A0A2W6B2P8 | 112-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.