DPCstruct | MC2489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 6.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7FCN2 | 5-64 | ALKSWVGQQLHRVMGMSDATLAEYLIELSRRRASPAQVLDELREEVPVDGKIEAFVEELY |
| A0A6A3BG35 | 1-84 | MSNLGGGVGNPLKTWVSDRLMSLLGFSQPTLVEYTIGLAKQAASPADVLGKLVEYGLPSSADVRVFAEEIFGKVPRKASGENVS |
| A0A1D6PZ79 | 1-76 | None |
| A0A1D2MZH7 | 1-75 | None |
| A0A4Z2CD80 | 3-76 | None |
| A0A0B7BCM1 | 1-78 | None |
| A0A251T796 | 40-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.