DPCstruct | MC24889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 165 ± 18 aa |
| Standard deviation of domain lengths | 18.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.29 |
| Pfam Score | 92.95 |
| Assigned Pfam label(s) | PF06949- PF12527 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q7XU97 | 38-203 | LECVIRRVFKSSDRDECMLLCPVDTPVQILKSTRDGWSAISDEEDESVLPAAAYALAKIHMHLVYSGYCYTARGGFCYTDKDILDFH… |
| B1XPB3 | 18-172 | TEYYFLMPVDQPVVILAWDEDEADESDLPETELVEDPEELAEIFPDAKAVLAEHDLILQDTAHVMTVRGELPPLEEDKILSLEIEDD… |
| A0A835N2E2 | 335-508 | None |
| A0A1U7I9A7 | 23-191 | None |
| A0A1E7F2H6 | 28-208 | None |
| A0A4S8IPS2 | 8-198 | None |
| A0A6J0M8A6 | 1-124 | None |
| A0A7R9TH84 | 47-218 | None |
| L1K239 | 5-160 | None |
| A0A6P5ZDK7 | 123-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.