DPCstruct | MC24885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 181 ± 48 aa |
| Standard deviation of domain lengths | 48.48 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 73.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10180 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4G6T4 | 8-184 | KKQRGKLKADKSKKEVAKTHVKFDDNGDKVVPKKRARVAKKKDADEVKEGGGKSDRSPEMIQQAKYYLEQWQKRDEPKADDELPWKF… |
| A0A0G4IIL3 | 21-150 | VERQKKRKQELKAARVVKGIAKQEALDKERAAKSLDDALQYLTLWDTNRSEWKFHKKRQITLLKNMLDRTRVPKPQFKILLRYLGGL… |
| A0A369S3V4 | 17-150 | None |
| M3D9K1 | 136-362 | None |
| A0A834QU34 | 112-296 | None |
| A0A1Y1V7S2 | 128-274 | None |
| E7FH60 | 77-257 | None |
| W6Z650 | 275-444 | None |
| A0A1A6A2N1 | 48-311 | None |
| A0A317SGT6 | 261-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.