DPCstruct | MC24883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 5.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 38.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4FNG4 | 1-71 | MSTPTKSRFTEDEDILLLREINGRLPFMAKRGQVMVRWSAVAEAVQSQDGFDRPGFDGKRAQNRFTLLLEG |
| A0A6A4FXN2 | 1-72 | MTEPTKRKNFSDEEDVLLLKQALADQPHQQEHDNVIERWNSLATTSVSSPDFTRKNLSGKTAQNRVNVLLVA |
| W4GIG2 | 1-84 | None |
| A0A6A3Q651 | 6-90 | None |
| W2ZLM2 | 111-191 | None |
| A0A3R6ZIW3 | 1-71 | None |
| W2LJX6 | 15-91 | None |
| A0A833T2R7 | 29-99 | None |
| A0A6A3UQN9 | 4-78 | None |
| A0A024TLM7 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.