DPCstruct | MC2488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 203 ± 34 aa |
| Standard deviation of domain lengths | 33.71 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0114 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6J4Z5 | 4-170 | FVTLTSFTPAISNTTDKAVKPTKPKKALNAFIGFRCYYISMLEFKAFPMKKLSNMLAEMWNEDTNKPVWALLAKTWSHICNQIGKEN… |
| D9J291 | 1-222 | MPPLTSSMPKGHVNYHNSNIHGRHRGPKKALNSWMAFRVYYKRIFPTLQQKEASRYLTTLWQRDPFKAKWTVIAAAYSKIRDEVGKQ… |
| A0A1J0A1F1 | 13-245 | None |
| A0A2U3E941 | 551-729 | None |
| A0A8A3P2R9 | 43-225 | None |
| Q9Y8D7 | 30-227 | None |
| M4PI74 | 1-134 | None |
| A0A0A1TE06 | 1-205 | None |
| A0A178F062 | 30-235 | None |
| A0A6G1G309 | 2-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.