DPCstruct | MC24878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 138 ± 11 aa |
| Standard deviation of domain lengths | 10.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W8ELU6 | 33-178 | VLGDVSYVRKFGTEPTPTTDEHLRVTAHFQYVEAVLQRKGTRALTNRQRRNRYHALKLLRNYWMAGQYPANYDFPHERRPCLIDRTG… |
| A0A1S9AUZ4 | 28-165 | VSYKPAAVEPVLSVADEHARIAAHLQYTEDVLRHKGTRGMPSHLRRRRYRTLKLLHAYWTTGLFPIDTEHPARRRPCLMDRDGRVCA… |
| A0A848L8R2 | 35-181 | None |
| A0A815QCQ8 | 34-173 | None |
| A0A4R6K5Z1 | 6-135 | None |
| A1ZXF9 | 28-170 | None |
| A0A356KX86 | 28-145 | None |
| A0A1M3IEJ3 | 42-176 | None |
| A0A2R6LXG3 | 11-137 | None |
| A0A815PIG5 | 11-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.