DPCstruct | MC24877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 83 ± 12 aa |
| Standard deviation of domain lengths | 12.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0FPC1 | 1-96 | FLYGVDGRCNAGFGFWQTAVGSRAALTAENYEKASNLLLGMKATNGEPLGIRPTTLVVGPKNRAAAKRIIDAMLVNGGDSNIWYKDV… |
| A0A377XV11 | 158-231 | APLTVANYEAAVKVLQGMKRDSGSPLGIRPTTLVVGPNNRAAAKKIIDAMLVDGGNSNIYYKDVEIVDSPFITT |
| A0A4C4ZNY7 | 1-77 | None |
| A0A259DWY8 | 102-192 | None |
| A0A0D6Q2Q1 | 99-210 | None |
| A0A2W5A762 | 356-430 | None |
| A0A377Z071 | 9-100 | None |
| A0A193QHK7 | 57-136 | None |
| A0A826NB17 | 101-172 | None |
| M9MB42 | 216-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.