DPCstruct | MC24876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 235 ± 21 aa |
| Standard deviation of domain lengths | 20.74 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.50 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF01295- CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5JUX4 | 77-292 | LDVDDFVDLGNLSGVPVREFLGTALWQMHKALSDPLKSVLKMALVATYLETDGPVQLLCDQLKAQVFKARRQEIVDPYLAVFKTVED… |
| A0A6D0FG83 | 1-193 | QGVLTPNEWLDLGGLSSLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLDPYCMMLE… |
| A0A380QEA4 | 36-263 | None |
| A0A448MTZ4 | 219-446 | None |
| A0A6L2ZQ34 | 218-450 | None |
| G2D905 | 1-277 | None |
| A0A355B1N9 | 285-550 | None |
| A0A6I4KMG4 | 1-221 | None |
| A0A3B0LZX6 | 219-449 | None |
| A0A376U0R7 | 3-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.