DPCstruct | MC24873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 135 ± 32 aa |
| Standard deviation of domain lengths | 31.55 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 92.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 25.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U3TM44 | 241-379 | TATAGDEGTATAGDEGTATAGYKGTATAGRWGTATAGYKGTATAGRWGTATAGRWGTATAGDKGTATAGDEGTATAGDEGTATAGYK… |
| A0A6D0F7Y4 | 2-113 | RIANTGMRVRVCTLGERCHVASNGDLVQIASFGANARIANSGDNVHIIASGENSTVVSTGVVDSIILGPGGSAALAYHDGERVRFAV… |
| A0A743YMQ5 | 253-381 | None |
| A0A3M1YKU2 | 26-204 | None |
| A0A759MBR1 | 3-130 | None |
| A0A554PPA5 | 35-195 | None |
| A0A857IVB3 | 108-220 | None |
| A0A855HHV9 | 1-97 | None |
| A0A4V3RTI5 | 116-199 | None |
| A0A1F9N9T3 | 87-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.