DPCstruct | MC24872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 130 ± 25 aa |
| Standard deviation of domain lengths | 25.18 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 47.09 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0062- PF13722 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4TG49 | 99-220 | LIEKESQARLIGYGGMLMESFVAIMALVAALSVDRGIYFAMNSPAGATGNTVKSAVAYVNSLGLSGVHANANTLTTTAKLVGETSIV… |
| A0A6D0EQD4 | 1-135 | YGAMLMESFVAIMALVAASIIEPGLYFAMNTPPAGLGITMPNLHEMGGENTAMIMAQLREASAHAAATVSSWGFVISPEQIMQTAKD… |
| A0A1H3R846 | 13-108 | None |
| A0A485CJF6 | 158-260 | None |
| A0A381GTT0 | 39-168 | None |
| A0A0V8D463 | 3-176 | None |
| A0A1R4JT66 | 1-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.