DPCstruct | MC24871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 132 ± 21 aa |
| Standard deviation of domain lengths | 21.00 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 55.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4IW15 | 2-114 | IVVKALTHSPWGTYTVAFTIPLAIFMGIYIRYLRPGRIGEVSVIGLVMLVFAIISGGWVAESPTWAPWFDYTGVQLTWILVGYGFVA… |
| A0A6D0EPB4 | 1-156 | VKEEMGATAGVIALIATFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLALFMGIYIRYLRPGRIGEVSIIGLFFLVFAIISGG… |
| A0A257SNC3 | 2-114 | None |
| A0A832FUZ2 | 96-211 | None |
| A0A087A716 | 50-211 | None |
| A0A6N8KBY7 | 2-108 | None |
| A0A485CJF6 | 2-111 | None |
| A0A2X3DRG2 | 1-106 | None |
| X8EZ34 | 78-239 | None |
| A0A0U1DDM0 | 7-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.