DPCstruct | MC24870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 96 ± 16 aa |
| Standard deviation of domain lengths | 15.82 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S9WZ56 | 14-101 | ALKNPLENISYTKKVLTQMSNKSDYFHSFPNAVDAFAKYGKKSEIIGNDGIKRVKIEIQGSYKNHDGVFEYIIEPDNTVNHRFFKIKE |
| A0A6D0EMM5 | 10-104 | KSSVINKILKADRIGSGLKPDPTHRGASYLSREQLMEGKVFTLKGGDGVERKLLQAEGSFNDKKGIYEYIYDKQGNVTHQRFIEGGN… |
| A0A3A9G3V6 | 129-219 | None |
| A0A7Y3ISF2 | 814-890 | None |
| A0A4S3ZUR8 | 207-300 | None |
| A0A7J0BWC5 | 305-412 | None |
| A0A0G0PX72 | 95-212 | None |
| A0A0M2VA78 | 1-68 | None |
| A0A7X5Q567 | 25-121 | None |
| A0A483AT07 | 68-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.