DPCstruct | MC2487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 57 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 45.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H7IUW1 | 101-149 | KATFLVQVKFRQNSSWQGQVLWSEKKKTVHFRSTLELLKLMNSALEQGS |
| A0A1G5W823 | 11-59 | GNSFVIEVKSQENYTWQGTITWVEGKKKENFRSALELMKLIDSTLGKKE |
| A0A7C6ZY42 | 2-66 | None |
| A0A4R1QEJ3 | 97-156 | None |
| A0A6N7WBL6 | 14-66 | None |
| A0A645J7F4 | 54-110 | None |
| A0A6N9QIE6 | 1-62 | None |
| A0A844K8P0 | 6-58 | None |
| A0A645FMS8 | 37-91 | None |
| A0A1I3ADQ3 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.