DPCstruct | MC24867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 230 ± 17 aa |
| Standard deviation of domain lengths | 16.58 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 21.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4R7I5 | 43-272 | YCIKIQSYVFQNKPVEALDIGQTLLHQFGVTFAKSPTPVDIQQSIQEINELIKDRKIADLFDLPVMTDRQILAIIQIAYALIPPAYN… |
| A0A7S1Y4Q4 | 435-663 | MVSKVAYLGSMSRYAEAISYAGSVVRLCGKPIPKNPGILQVLLALSTVRRVVARLTDDDIVKLPTVTDTKVDYMLQILSRVASYATM… |
| Q08NB7 | 231-464 | None |
| K0RP37 | 204-412 | None |
| A0A3N6PSI9 | 1-211 | None |
| A0A351L5G7 | 2-264 | None |
| A0A3N5TAB4 | 7-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.