DPCstruct | MC24864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 78 ± 14 aa |
| Standard deviation of domain lengths | 13.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 62.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803NND1 | 1-71 | MVLKKKKLVFPPPIPLLARTQNLPCRMPWVLTRHYTSDGRLILTEEKLPRHEYFRAHRSNGRLTLQLVPLD |
| A0A5A7V582 | 49-107 | NKKMKDEKEYPPPIPLLVVMKRHYTGDGRLILTEEKIKHRGFLRAQRSDGRLMLQLVAV |
| A0A218Y0B0 | 1-75 | None |
| A0A6J1JTI2 | 43-122 | None |
| A0A6J1CJ12 | 88-158 | None |
| A0A5N5HQR3 | 113-223 | None |
| A0A5N5HLQ3 | 79-145 | None |
| A0A833WID1 | 85-174 | None |
| A0A314UVN1 | 1-79 | None |
| A0A0B2R1X9 | 44-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.