DPCstruct | MC24862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 7.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4TK98 | 225-312 | VARTMLIMPNYQTDSINTIVTMSAPHARPPVTFDPQIVQIYEDINRHWRDSYSQRWADDNPLRQVTLVSIAGGGLDTVVPSDYASLES |
| A0A0R3WPV9 | 150-233 | MGGVVAHYALAKAKFDPSMVNWVITLASPLRSPVVALGVHLLRIYERIYKFWRSVPLDNSYEHVTFLSITGGISDHQVWDGLGK |
| A0A7J6JHE0 | 358-445 | None |
| A0A317SF20 | 22-105 | None |
| A0A0R3T3K1 | 593-672 | None |
| A0A7R9PB19 | 256-346 | None |
| A0A453KIL2 | 11-100 | None |
| A0A226MP59 | 181-270 | None |
| A0A2P2K408 | 5-108 | None |
| A0A5C7HF18 | 221-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.