DPCstruct | MC2486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Standard deviation of domain lengths | 13.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A174ETA1 | 127-228 | ELIVKDVMNGSGDTVIGQCAYISITAKQLEDMTSAHLREFAESRVNGANYNWVSIMATDGTGICFPGSDISSAIYGNLGKDGSLVDT… |
| A0A1G5VW18 | 16-153 | IVPTILLVCFILYSHFSGKTLKWPWAVESENDFLPNAKIYSAKVYDATGEEYLGERGYIKVGPTELASLTPTQYYNYYNTVLKNTDY… |
| A0A6L9HD17 | 79-195 | None |
| A0A496NBX8 | 20-132 | None |
| T0D6N2 | 21-156 | None |
| A0A3N0I0X0 | 200-319 | None |
| A0A3A9ERD9 | 121-240 | None |
| A0A2G3DYB3 | 141-277 | None |
| A0A1I7FE04 | 43-143 | None |
| A0A2U2EKL3 | 60-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.