DPCstruct | MC24856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 461 ± 88 aa |
| Standard deviation of domain lengths | 88.31 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 22.42 |
| Pfam Score | 95.48 |
| Assigned Pfam label(s) | PF18077- CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2W8R3 | 2-301 | IAMEKLLEEKEKGLETKVAENDTICAENTELRKRVEEQGINARDAERMKREIQALERDIGDIENQRNEWEEKAWDLDSTARNEYRKL… |
| A0A314UG32 | 21-505 | LSSINSYLASHSMQIFLKFPIPSAKEITETLKFLVARLDYPNPKLEDDLPVILKFLKCPFKPNKSMLRNPTVNHHQWPTLLAVIHWL… |
| A0A822XZ04 | 3-295 | None |
| A0A1R2D338 | 1-353 | None |
| A0A4Y7JCQ0 | 52-539 | None |
| A0A6A6L0I7 | 406-818 | None |
| A0A3N4KM57 | 26-562 | None |
| A0A1A8BI74 | 10-358 | None |
| A0A0G4KWR5 | 2-515 | None |
| A0A1R3I3H8 | 590-1066 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.