DPCstruct | MC24855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 144 ± 2 aa |
| Standard deviation of domain lengths | 2.25 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 76.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 58.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835YNJ0 | 77-220 | LASRAEEVEAVRAAKDLPLLRGFDEELKRAARRRRTAASTAAGNPQPPRGEWTFHGYQAWERPGLQPPPAQALKLLYRLASDPGIVG… |
| A0A5J4XXM9 | 80-220 | YASTKEEVEQVRNSKDLPGLASFEQELKQTMRRQRGSSRGKLTLPSGPYTFQKFEAWQHPGLSPMPSEAIKLLHRLAADPGIIGIMS… |
| A0A0W8CKH4 | 74-213 | None |
| A0A6P5TXD1 | 1-147 | None |
| D8TSY8 | 78-219 | None |
| A0A067K749 | 65-209 | None |
| A0A061DKQ1 | 224-368 | None |
| A0A1D2A6B7 | 88-227 | None |
| A0A811PR84 | 86-231 | None |
| A0A438BQU0 | 305-449 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.