DPCstruct | MC24854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 4.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 67.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9BJZ1 | 1-64 | MQVPQVTKEAAFAVIELYPTVISLAWAYSMLDGDTQAQEELLKNKSKMVNAGASRNIFNLIWAE |
| A0A314UFI8 | 12-74 | MQVPQVTEEVALAVLDLYPTLLSLARAYSLLESDVAAQEEMLRTQSNNVVNAGASKNIFHLVW |
| A0A287MKB1 | 204-265 | None |
| A0A0A9H7M2 | 1-64 | None |
| A0A5J5B3T8 | 1192-1255 | None |
| A0A3L6PT87 | 894-955 | None |
| A0A453T449 | 10-86 | None |
| A0A6N2NEM5 | 19-82 | None |
| M5XMU6 | 229-301 | None |
| S8DXE1 | 468-530 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.