DPCstruct | MC24851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 227 ± 41 aa |
| Standard deviation of domain lengths | 40.78 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20533 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849ZAA4 | 1-179 | MCGGMYVKAVNKTQTKCFDGTKADECYVASIDHSPLGLSGTQSEEVMAAIREGRVLLSGEMVELDAPAGGFASLLTYKAFEAETGNT… |
| A0A519ZI21 | 33-230 | NTRDYIVTGIDLRKCAFPMCGGYFVKAVNQGLTRCADGSLQKQCHVPVVDTSQRGWTDKDRAAFTDAFAQGHALARGILRTVTNPST… |
| A0A538QAK8 | 1-193 | None |
| F4PUR8 | 225-466 | None |
| F4PYN1 | 291-610 | None |
| Q55BI7 | 1-253 | None |
| A0A1Y6CDG6 | 152-390 | None |
| Q54HV1 | 16-264 | None |
| A0A7Y4ZJ28 | 33-266 | None |
| A0A661P2T2 | 32-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.